Lineage for d6v2gd1 (6v2g D:1-326)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911318Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2911319Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2911320Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 proteins)
    automatically mapped to Pfam PF00710
  6. 2911321Protein Asparaginase type II [53776] (5 species)
  7. 2911374Species Escherichia coli [TaxId:562] [53777] (42 PDB entries)
  8. 2911453Domain d6v2gd1: 6v2g D:1-326 [385881]
    Other proteins in same PDB: d6v2gc2, d6v2gd2
    automated match to d1jaza_
    mutant

Details for d6v2gd1

PDB Entry: 6v2g (more details), 1.9 Å

PDB Description: complex of mutant (k162m) of e. coli l-asparaginase ii with l-asp. covalent acyl-enzyme intermediate and tetrahedral intermediate.
PDB Compounds: (D:) L-asparaginase 2

SCOPe Domain Sequences for d6v2gd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v2gd1 c.88.1.1 (D:1-326) Asparaginase type II {Escherichia coli [TaxId: 562]}
lpnitilatggdiagggdsatksnytvgkvgvenlvnavpqlkdianvkgeqvvnigsqd
mndnvwltlakkintdcdktdgfvithgtdtmeetayfldltvkcdkpvvmvgamrpsts
msadgpfnlynavvtaadkasanrgvlvvmndtvldgrdvtmtnttdvatfksvnygplg
yihngkidyqrtparkhtsdtpfdvsklnelpkvgivynyanasdlpakalvdagydgiv
sagvgngnlyksvfdtlataaktgtavvrssrvptgattqdaevddakygfvasgtlnpq
karvllqlaltqtkdpqqiqqifnqy

SCOPe Domain Coordinates for d6v2gd1:

Click to download the PDB-style file with coordinates for d6v2gd1.
(The format of our PDB-style files is described here.)

Timeline for d6v2gd1: