Lineage for d1fiqc1 (1fiq C:571-694)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79412Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 79413Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 79414Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (3 proteins)
  6. 79429Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 79430Species Cow (Bos taurus) [TaxId:9913] [54671] (2 PDB entries)
  8. 79433Domain d1fiqc1: 1fiq C:571-694 [38588]
    Other proteins in same PDB: d1fiqa1, d1fiqa2, d1fiqb1, d1fiqb2, d1fiqc2

Details for d1fiqc1

PDB Entry: 1fiq (more details), 2.5 Å

PDB Description: crystal structure of xanthine oxidase from bovine milk

SCOP Domain Sequences for d1fiqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiqc1 d.41.1.1 (C:571-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus)}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

SCOP Domain Coordinates for d1fiqc1:

Click to download the PDB-style file with coordinates for d1fiqc1.
(The format of our PDB-style files is described here.)

Timeline for d1fiqc1: