Lineage for d1dgja3 (1dgj A:194-310)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721795Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 721796Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 721797Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 721804Protein Aldehyde oxidoreductase, domain 3 [54667] (2 species)
  7. 721805Species Desulfovibrio desulfuricans [TaxId:876] [54669] (1 PDB entry)
  8. 721806Domain d1dgja3: 1dgj A:194-310 [38585]
    Other proteins in same PDB: d1dgja1, d1dgja2, d1dgja4
    complexed with 2mo, fes, mcn

Details for d1dgja3

PDB Entry: 1dgj (more details), 2.8 Å

PDB Description: crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774
PDB Compounds: (A:) aldehyde oxidoreductase

SCOP Domain Sequences for d1dgja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgja3 d.41.1.1 (A:194-310) Aldehyde oxidoreductase, domain 3 {Desulfovibrio desulfuricans [TaxId: 876]}
efgadaalrmpentlhlalaqakvshalikgidtseaekmpgvykvlthkdvkgknritg
litfptnkgdgwerpilndskifqygdalaivcadseanaraaaekvkfdlellpey

SCOP Domain Coordinates for d1dgja3:

Click to download the PDB-style file with coordinates for d1dgja3.
(The format of our PDB-style files is described here.)

Timeline for d1dgja3: