| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) ![]() |
| Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins) |
| Protein Aldehyde oxidoreductase, domain 3 [54667] (2 species) |
| Species Desulfovibrio desulfuricans [TaxId:876] [54669] (1 PDB entry) |
| Domain d1dgja3: 1dgj A:194-310 [38585] Other proteins in same PDB: d1dgja1, d1dgja2, d1dgja4 complexed with 2mo, fes, mcn |
PDB Entry: 1dgj (more details), 2.8 Å
SCOP Domain Sequences for d1dgja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dgja3 d.41.1.1 (A:194-310) Aldehyde oxidoreductase, domain 3 {Desulfovibrio desulfuricans}
efgadaalrmpentlhlalaqakvshalikgidtseaekmpgvykvlthkdvkgknritg
litfptnkgdgwerpilndskifqygdalaivcadseanaraaaekvkfdlellpey
Timeline for d1dgja3: