Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [385765] (2 PDB entries) |
Domain d6n44f_: 6n44 F: [385827] Other proteins in same PDB: d6n44a2 automated match to d2dyca_ complexed with gol |
PDB Entry: 6n44 (more details), 2 Å
SCOPe Domain Sequences for d6n44f_:
Sequence, based on SEQRES records: (download)
>d6n44f_ b.29.1.0 (F:) automated matches {Sheep (Ovis aries) [TaxId: 9940]} slpnpylqsvsltvcymvkikanllspfgknpelqvdfgtgtgqggdipfrfwycdgivv mntlkdgswgkeqklhteafvpgqpfelqflvleneyqvfvnnkpicqfahrlplqsvkm ldvrgdivltsvdtl
>d6n44f_ b.29.1.0 (F:) automated matches {Sheep (Ovis aries) [TaxId: 9940]} slpnpylqsvsltvcymvkikanllspfgknpelqvdfgtgtggdipfrfwycdgivvmn tlkdgswgkeqklhteafvpgqpfelqflvleneyqvfvnnkpicqfahrlplqsvkmld vrgdivltsvdtl
Timeline for d6n44f_: