Lineage for d1mit__ (1mit -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79376Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
  4. 79377Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) (S)
  5. 79378Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)
  6. 79407Protein Trypsin inhibitor V [54660] (1 species)
  7. 79408Species Pumpkin (Cucurbita maxima) [TaxId:3661] [54661] (3 PDB entries)
  8. 79411Domain d1mit__: 1mit - [38582]

Details for d1mit__

PDB Entry: 1mit (more details)

PDB Description: recombinant cucurbita maxima trypsin inhibitor v (rcmti-v) (nmr, minimized average structure)

SCOP Domain Sequences for d1mit__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mit__ d.40.1.1 (-) Trypsin inhibitor V {Pumpkin (Cucurbita maxima)}
gsscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtkdfrcnrvriwvnkrg
lvvspprig

SCOP Domain Coordinates for d1mit__:

Click to download the PDB-style file with coordinates for d1mit__.
(The format of our PDB-style files is described here.)

Timeline for d1mit__: