![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
![]() | Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) ![]() |
![]() | Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
![]() | Protein automated matches [227047] (11 species) not a true protein |
![]() | Species Tick-borne encephalitis virus [TaxId:11084] [385818] (1 PDB entry) |
![]() | Domain d6s8cb1: 6s8c B:2-302 [385819] Other proteins in same PDB: d6s8ca1, d6s8cb2, d6s8cc1 automated match to d4gsxa1 |
PDB Entry: 6s8c (more details), 2.57 Å
SCOPe Domain Sequences for d6s8cb1:
Sequence, based on SEQRES records: (download)
>d6s8cb1 f.10.1.0 (B:2-302) automated matches {Tick-borne encephalitis virus [TaxId: 11084]} rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl haklsdtkvaarcptmgpatlaeehqggtvckrdqsdrghgnhcglfgkgsivacvkaac eakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeygd vsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaerl vefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkg l
>d6s8cb1 f.10.1.0 (B:2-302) automated matches {Tick-borne encephalitis virus [TaxId: 11084]} rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl haklsdtkehqggtvckacvkaaceakkkatghvydankivytvkvephrktasftisse ktiltmgeygdvsllcrvasgvdlaqtvileldptawqvhrdwfndlalpwkhegaqnwn naerlvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevglek lkmkgl
Timeline for d6s8cb1: