Lineage for d6s8cb1 (6s8c B:2-302)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628446Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2628447Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2628492Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2628493Protein automated matches [227047] (11 species)
    not a true protein
  7. 2628512Species Tick-borne encephalitis virus [TaxId:11084] [385818] (1 PDB entry)
  8. 2628513Domain d6s8cb1: 6s8c B:2-302 [385819]
    Other proteins in same PDB: d6s8ca1, d6s8cb2, d6s8cc1
    automated match to d4gsxa1

Details for d6s8cb1

PDB Entry: 6s8c (more details), 2.57 Å

PDB Description: post-fusion conformation of the envelope protein of tick-borne encephalitis virus with longer stem
PDB Compounds: (B:) Genome polyprotein,Genome polyprotein

SCOPe Domain Sequences for d6s8cb1:

Sequence, based on SEQRES records: (download)

>d6s8cb1 f.10.1.0 (B:2-302) automated matches {Tick-borne encephalitis virus [TaxId: 11084]}
rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
haklsdtkvaarcptmgpatlaeehqggtvckrdqsdrghgnhcglfgkgsivacvkaac
eakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeygd
vsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaerl
vefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkg
l

Sequence, based on observed residues (ATOM records): (download)

>d6s8cb1 f.10.1.0 (B:2-302) automated matches {Tick-borne encephalitis virus [TaxId: 11084]}
rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
haklsdtkehqggtvckacvkaaceakkkatghvydankivytvkvephrktasftisse
ktiltmgeygdvsllcrvasgvdlaqtvileldptawqvhrdwfndlalpwkhegaqnwn
naerlvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevglek
lkmkgl

SCOPe Domain Coordinates for d6s8cb1:

Click to download the PDB-style file with coordinates for d6s8cb1.
(The format of our PDB-style files is described here.)

Timeline for d6s8cb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6s8cb2