Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Tick-borne encephalitis virus [TaxId:11084] [364682] (3 PDB entries) |
Domain d6s8ca1: 6s8c A:303-404 [385811] Other proteins in same PDB: d6s8cb1 automated match to d4gsxa2 |
PDB Entry: 6s8c (more details), 2.57 Å
SCOPe Domain Sequences for d6s8ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s8ca1 b.1.18.0 (A:303-404) automated matches {Tick-borne encephalitis virus [TaxId: 11084]} tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp tienngggfiemqlppgdniiyvgelshqwfqkgssigrvfq
Timeline for d6s8ca1: