Lineage for d1hym.1 (1hym A:,B:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) 
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins) 
Protein Trypsin inhibitor V [54660] (1 species) Species Pumpkin (Cucurbita maxima) [TaxId:3661] [54661] (3 PDB entries) 
Domain d1hym.1: 1hym A:,B: [38581]
Details for d1hym.1
PDB Entry: 1hym (more details)
PDB Description: hydrolyzed trypsin inhibitor (cmti-v, minimized average nmr structure)
SCOP Domain Sequences for d1hym.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1hym.1 d.40.1.1 (A:,B:) Trypsin inhibitor V {Pumpkin (Cucurbita maxima)}
sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtkXdfrcnrvriwvnkrg
lvvspprig
SCOP Domain Coordinates for d1hym.1:
Click to download the PDB-style file with coordinates for d1hym.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hym.1:
- d1hym.1 first appeared (with stable ids) in SCOP 1.55
- d1hym.1 appears in SCOP 1.57
- d1hym.1 appears in SCOP 1.61
- d1hym.1 appears in the current release, SCOPe 2.08
View in 3D