![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
![]() | Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) ![]() |
![]() | Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
![]() | Protein Trypsin inhibitor V [54660] (1 species) |
![]() | Species Pumpkin (Cucurbita maxima) [TaxId:3661] [54661] (3 PDB entries) |
![]() | Domain d1hym.1: 1hym A:,B: [38581] |
PDB Entry: 1hym (more details)
SCOPe Domain Sequences for d1hym.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1hym.1 d.40.1.1 (A:,B:) Trypsin inhibitor V {Pumpkin (Cucurbita maxima) [TaxId: 3661]} sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtkXdfrcnrvriwvnkrg lvvspprig
Timeline for d1hym.1: