SCOPe 2.08: Domain d1hym.1: 1hym A:,B:

Lineage for d1hym.1 (1hym A:,B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein Trypsin inhibitor V [54660] (1 species)

7. Species Pumpkin (Cucurbita maxima) [TaxId:3661] [54661] (3 PDB entries)

8. Domain d1hym.1: 1hym A:,B: [38581]

Details for d1hym.1

PDB Entry: 1hym

PDB Description: hydrolyzed trypsin inhibitor (cmti-v, minimized average nmr structure)

PDB Compounds: (A:) hydrolyzed cucurbita maxima trypsin inhibitor v, (B:) hydrolyzed cucurbita maxima trypsin inhibitor v

SCOPe Domain Sequences for d1hym.1:

Sequence; same for both SEQRES and ATOM records:

>g1hym.1 d.40.1.1 (A:,B:) Trypsin inhibitor V {Pumpkin (Cucurbita maxima) [TaxId: 3661]}
sscpgksswphlvgvggsvakaiierqnpnvkavileegtpvtkXdfrcnrvriwvnkrg
lvvspprig

Timeline for d1hym.1:

• d1hym.1 first appeared (with stable ids) in SCOP 1.55
  
• d1hym.1 appears in SCOPe 2.07