SCOPe 2.06: Domain d1cq4.1: 1cq4 A:,B:

Lineage for d1cq4.1 (1cq4 A:,B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
   Uniprot Q40059 22-84

8. Domain d1cq4.1: 1cq4 A:,B: [38579]
   mutant with insertion (GQQQQGM) between met59 and glu60
   complexed with so4; mutant

Details for d1cq4.1

PDB Entry: 1cq4, 1.8 Å

PDB Description: ci2 mutant with tetraglutamine (mgqqqqgm) replacing met59

PDB Compounds: (A:) protein (serine proteinase inhibitor 2), (B:) protein (serine proteinase inhibitor 2)

SCOPe Domain Sequences for d1cq4.1:

Sequence; same for both SEQRES and ATOM records:

>g1cq4.1 d.40.1.1 (A:,B:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
ktewpelvgksveeakkvilqdkpeaqiivlpvgtivXyridrvrlfvdkldniaqvprv
g

Timeline for d1cq4.1:

• d1cq4.1 first appeared (with stable ids) in SCOP 1.55
  
• d1cq4.1 appears in SCOPe 2.05
  
• d1cq4.1 appears in SCOPe 2.07
  
• d1cq4.1 appears in the current release, SCOPe 2.08