Lineage for d1cq4.1 (1cq4 A:,B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944763Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2944764Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2944765Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 2944766Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 2944767Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. 2944796Domain d1cq4.1: 1cq4 A:,B: [38579]
    mutant with insertion (GQQQQGM) between met59 and glu60
    complexed with so4; mutant

Details for d1cq4.1

PDB Entry: 1cq4 (more details), 1.8 Å

PDB Description: ci2 mutant with tetraglutamine (mgqqqqgm) replacing met59
PDB Compounds: (A:) protein (serine proteinase inhibitor 2), (B:) protein (serine proteinase inhibitor 2)

SCOPe Domain Sequences for d1cq4.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1cq4.1 d.40.1.1 (A:,B:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
ktewpelvgksveeakkvilqdkpeaqiivlpvgtivXyridrvrlfvdkldniaqvprv
g

SCOPe Domain Coordinates for d1cq4.1:

Click to download the PDB-style file with coordinates for d1cq4.1.
(The format of our PDB-style files is described here.)

Timeline for d1cq4.1: