Lineage for d1cir.1 (1cir A:,B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31776Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
  4. 31777Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) (S)
  5. 31778Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)
  6. 31779Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 31780Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (10 PDB entries)
  8. 31790Domain d1cir.1: 1cir A:,B: [38578]

Details for d1cir.1

PDB Entry: 1cir (more details)

PDB Description: complex of two fragments of ci2 [(1-40)(dot)(41-64)]

SCOP Domain Sequences for d1cir.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1cir.1 d.40.1.1 (A:,B:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare)}
mktewpelvgksveeakkvilqdkpeaqiivlpvgtivtXeyridrvrlfvdkldniaqv
prvg

SCOP Domain Coordinates for d1cir.1:

Click to download the PDB-style file with coordinates for d1cir.1.
(The format of our PDB-style files is described here.)

Timeline for d1cir.1: