SCOPe 2.08: Domain d1cir.1: 1cir A:,B:

Lineage for d1cir.1 (1cir A:,B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
   Uniprot Q40059 22-84

8. Domain d1cir.1: 1cir A:,B: [38578]

Details for d1cir.1

PDB Entry: 1cir

PDB Description: complex of two fragments of ci2 [(1-40)(dot)(41-64)]

PDB Compounds: (A:) chymotrypsin inhibitor 2, (B:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1cir.1:

Sequence; same for both SEQRES and ATOM records:

>g1cir.1 d.40.1.1 (A:,B:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
mktewpelvgksveeakkvilqdkpeaqiivlpvgtivtXeyridrvrlfvdkldniaqv
prvg

Timeline for d1cir.1:

• d1cir.1 first appeared (with stable ids) in SCOP 1.55
  
• d1cir.1 appears in SCOPe 2.07