Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Ovis aries [TaxId:9940] [385765] (2 PDB entries) |
Domain d6n44h_: 6n44 H: [385773] Other proteins in same PDB: d6n44a2 automated match to d2dyca_ complexed with gol |
PDB Entry: 6n44 (more details), 2 Å
SCOPe Domain Sequences for d6n44h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n44h_ b.29.1.0 (H:) automated matches {Ovis aries [TaxId: 9940]} slpnpylqsvsltvcymvkikanllspfgknpelqvdfgtgtgqggdipfrfwycdgivv mntlkdgswgkeqklhteafvpgqpfelqflvleneyqvfvnnkpicqfahrlplqsvkm ldvrgdivltsvdtl
Timeline for d6n44h_: