SCOPe 2.07: Domain d6l1yc1: 6l1y C:1-97

Lineage for d6l1yc1 (6l1y C:1-97)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries)

8. Domain d6l1yc1: 6l1y C:1-97 [385768]
   Other proteins in same PDB: d6l1yc2
   automated match to d2nxyb1
   complexed with epe, nag

Details for d6l1yc1

PDB Entry: 6l1y, 2.47 Å

PDB Description: structure of gp120/cd4 with a non-canonical surface

PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d6l1yc1:

Sequence; same for both SEQRES and ATOM records:

>d6l1yc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d6l1yc1:

• d6l1yc1 is new in SCOPe 2.07-stable
  
• d6l1yc1 appears in the current release, SCOPe 2.08