Lineage for d6n44c_ (6n44 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390874Species Ovis aries [TaxId:9940] [385765] (2 PDB entries)
  8. 2390877Domain d6n44c_: 6n44 C: [385767]
    Other proteins in same PDB: d6n44a2
    automated match to d2dyca_
    complexed with gol

Details for d6n44c_

PDB Entry: 6n44 (more details), 2 Å

PDB Description: sheep galectin-11 (lgals11) complex with glycerol
PDB Compounds: (C:) galectin

SCOPe Domain Sequences for d6n44c_:

Sequence, based on SEQRES records: (download)

>d6n44c_ b.29.1.0 (C:) automated matches {Ovis aries [TaxId: 9940]}
slpnpylqsvsltvcymvkikanllspfgknpelqvdfgtgtgqggdipfrfwycdgivv
mntlkdgswgkeqklhteafvpgqpfelqflvleneyqvfvnnkpicqfahrlplqsvkm
ldvrgdivltsvdtl

Sequence, based on observed residues (ATOM records): (download)

>d6n44c_ b.29.1.0 (C:) automated matches {Ovis aries [TaxId: 9940]}
slpnpylqsvsltvcymvkikanllspknpelqvdfgtgtgqggdipfrfwycdgivvmn
tlkdgswgkeqklhteafvpgqpfelqflvleneyqvfvnnkpicqfahrlplqsvkmld
vrgdivltsvdtl

SCOPe Domain Coordinates for d6n44c_:

Click to download the PDB-style file with coordinates for d6n44c_.
(The format of our PDB-style files is described here.)

Timeline for d6n44c_: