Lineage for d6n44b_ (6n44 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781319Species Sheep (Ovis aries) [TaxId:9940] [385765] (2 PDB entries)
  8. 2781321Domain d6n44b_: 6n44 B: [385766]
    Other proteins in same PDB: d6n44a2
    automated match to d2dyca_
    complexed with gol

Details for d6n44b_

PDB Entry: 6n44 (more details), 2 Å

PDB Description: sheep galectin-11 (lgals11) complex with glycerol
PDB Compounds: (B:) galectin

SCOPe Domain Sequences for d6n44b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n44b_ b.29.1.0 (B:) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
slpnpylqsvsltvcymvkikanllspfgknpelqvdfgtgtgqggdipfrfwycdgivv
mntlkdgswgkeqklhteafvpgqpfelqflvleneyqvfvnnkpicqfahrlplqsvkm
ldvrgdivltsvdtl

SCOPe Domain Coordinates for d6n44b_:

Click to download the PDB-style file with coordinates for d6n44b_.
(The format of our PDB-style files is described here.)

Timeline for d6n44b_: