Lineage for d1coai_ (1coa I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551816Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2551817Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2551818Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 2551819Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 2551820Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. 2551846Domain d1coai_: 1coa I: [38574]
    mutant

Details for d1coai_

PDB Entry: 1coa (more details), 2.2 Å

PDB Description: the effect of cavity creating mutations in the hydrophobic core of chymotrypsin inhibitor 2
PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1coai_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1coai_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
mktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldnvaev
prvg

SCOPe Domain Coordinates for d1coai_:

Click to download the PDB-style file with coordinates for d1coai_.
(The format of our PDB-style files is described here.)

Timeline for d1coai_: