![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
![]() | Protein automated matches [190075] (132 species) not a true protein |
![]() | Species Aspergillus fumigatus [TaxId:1437362] [385731] (6 PDB entries) |
![]() | Domain d6je1a_: 6je1 A: [385736] automated match to d3cuia_ complexed with gol, mes, nag, peg, xyp |
PDB Entry: 6je1 (more details), 1.18 Å
SCOPe Domain Sequences for d6je1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6je1a_ c.1.8.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 1437362]} aglntaakakglkyfgsatdnpeltdsayvaqlsntddfgqitpgnsmkwdatepsqnsf sfangdavvnlankngqlmrchtlvwhsqlpnwvssgswtnatllaamknhitnvvthyk gkcyawdvvnealnedgtfrnsvfyqiigpayipiafataaaadpdvklyyndynieysg akataaqnivkmikaygakidgvglqahfivgstpsqsdlttvlkgytalgvevayteld irmqlpstaaklaqqstdfqgvaaacvsttgcvgvtiwdwtdkyswvpsvfqgygaplpw denyvkkpaydglmaglga
Timeline for d6je1a_: