Lineage for d2snii_ (2sni I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1902783Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1902784Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1902785Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 1902786Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. 1902787Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. 1902809Domain d2snii_: 2sni I: [38573]
    Other proteins in same PDB: d2snie_
    complexed with ca

Details for d2snii_

PDB Entry: 2sni (more details), 2.1 Å

PDB Description: structural comparison of two serine proteinase-protein inhibitor complexes. eglin-c-subtilisin carlsberg and ci-2-subtilisin novo
PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d2snii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2snii_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
lktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniaev
prvg

SCOPe Domain Coordinates for d2snii_:

Click to download the PDB-style file with coordinates for d2snii_.
(The format of our PDB-style files is described here.)

Timeline for d2snii_: