Lineage for d2snii_ (2sni I:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) 
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins) 
Protein Chymotrypsin inhibitor CI-2 [54658] (1 species) Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (10 PDB entries) 
Domain d2snii_: 2sni I: [38573]
Other proteins in same PDB: d2snie_
Details for d2snii_
PDB Entry: 2sni (more details), 2.1 Å
PDB Description: structural comparison of two serine proteinase-protein inhibitor complexes. eglin-c-subtilisin carlsberg and ci-2-subtilisin novo
SCOP Domain Sequences for d2snii_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2snii_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare)}
lktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniaev
prvg
SCOP Domain Coordinates for d2snii_:
Click to download the PDB-style file with coordinates for d2snii_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2snii_:
- d2snii_ appears in SCOP 1.57
- d2snii_ appears in the current release, SCOPe 2.08
View in 3D
