SCOPe 2.04: Domain d1ypci_: 1ypc I:

Lineage for d1ypci_ (1ypc I:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
   Uniprot Q40059 22-84

8. Domain d1ypci_: 1ypc I: [38570]

Details for d1ypci_

PDB Entry: 1ypc, 1.7 Å

PDB Description: direct observation of better hydration at the n-terminus of an alpha- helix with glycine rather than alanine as n-cap

PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1ypci_:

Sequence; same for both SEQRES and ATOM records:

>d1ypci_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
mktewpelvgksvaaakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniaqv
prvg

Timeline for d1ypci_:

• d1ypci_ first appeared (with stable ids) in SCOP 1.55
  
• d1ypci_ appears in SCOPe 2.03
  
• d1ypci_ appears in SCOPe 2.05
  
• d1ypci_ appears in the current release, SCOPe 2.08