Lineage for d1ypci_ (1ypc I:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. Protein Chymotrypsin inhibitor CI-2 [54658] (1 species)
  7. Species Barley (Hordeum vulgare) [TaxId:4513] [54659] (29 PDB entries)
    Uniprot Q40059 22-84
  8. Domain d1ypci_: 1ypc I: [38570]

Details for d1ypci_

PDB Entry: 1ypc (more details), 1.7000000000000002 Å

PDB Description: direct observation of better hydration at the n-terminus of an alpha- helix with glycine rather than alanine as n-cap
PDB Compounds: (I:) chymotrypsin inhibitor 2

SCOPe Domain Sequences for d1ypci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypci_ d.40.1.1 (I:) Chymotrypsin inhibitor CI-2 {Barley (Hordeum vulgare) [TaxId: 4513]}
mktewpelvgksvaaakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniaqv
prvg

SCOPe Domain Coordinates for d1ypci_ are not available.

Timeline for d1ypci_: