SCOPe 2.07: Domain d6yvhh_: 6yvh H:

Lineage for d6yvhh_ (6yvh H:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein automated matches [190301] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187108] (5 PDB entries)

8. Domain d6yvhh_: 6yvh H: [385694]
   automated match to d1fuka_
   protein/RNA complex

Details for d6yvhh_

PDB Entry: 6yvh, 3.19 Å

PDB Description: cwc22-cwc27-eif4a3 complex

PDB Compounds: (H:) Eukaryotic initiation factor 4A-III

SCOPe Domain Sequences for d6yvhh_:

Sequence, based on SEQRES records:

>d6yvhh_ c.37.1.19 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanftvs
smhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrelyihri
grsgrygrkgvainfvknddirilrdieqyystqidempmnvadli

Sequence, based on observed residues (ATOM records):

>d6yvhh_ c.37.1.19 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanftvs
smhgdmpqkeresimkefrsgasrvlistdvwgldvpqvsliinydlpnnrelyihrigr
sgrrkgvainfvknddirilrdieqyystqidempmnvadli

Timeline for d6yvhh_:

• d6yvhh_ is new in SCOPe 2.07-stable
  
• d6yvhh_ appears in the current release, SCOPe 2.08