SCOPe 2.05: Domain d1sibi_: 1sib I:

Lineage for d1sibi_ (1sib I:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein Eglin C [54656] (1 species)

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)

8. Domain d1sibi_: 1sib I: [38568]
   Other proteins in same PDB: d1sibe_
   complexed with ca; mutant

Details for d1sibi_

PDB Entry: 1sib, 2.4 Å

PDB Description: refined crystal structures of subtilisin novo in complex with wild- type and two mutant eglins. comparison with other serine proteinase inhibitor complexes

PDB Compounds: (I:) eglin c

SCOPe Domain Sequences for d1sibi_:

Sequence; same for both SEQRES and ATOM records:

>d1sibi_ d.40.1.1 (I:) Eglin C {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvkvfynpgtnvvnhvp
hvg

Timeline for d1sibi_:

• d1sibi_ first appeared (with stable ids) in SCOP 1.55
  
• d1sibi_ appears in SCOPe 2.04
  
• d1sibi_ appears in SCOPe 2.06
  
• d1sibi_ appears in the current release, SCOPe 2.08