SCOPe 2.08: Domain d6wopb_: 6wop B:

Lineage for d6wopb_ (6wop B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [385676] (1 PDB entry)

8. Domain d6wopb_: 6wop B: [385677]
   automated match to d1sffa_
   complexed with cl, tar

Details for d6wopb_

PDB Entry: 6wop, 1.85 Å

PDB Description: crystal structure of gamma-aminobutyrate aminotransferase puue from acinetobacter baumannii

PDB Compounds: (B:) 4-aminobutyrate transaminase

SCOPe Domain Sequences for d6wopb_:

Sequence; same for both SEQRES and ATOM records:

>d6wopb_ c.67.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
qhsalnarkqqatprgvgvmcqwyaekaenatiwdkegnqfidfaggiavlntghrhpkv
iaavteqltkfthtayqvtpyesyvalaerinerapiagpakaaffttgaeavenavkia
rcytgrhgiitfgngfhgrsfmtmamtgktapykrdfgvmpagvfharypvpakgisvda
aiesvedifsediaphdvaaivlepvqgeggfnvvpaeflkrlraicdkhgillvadevq
sgfartgklfamnhyetkadlitmakslgggfpisgvvgraevmdapnpgglggtyagsp
iavaaahavidaieeenlcdranelgaelvatlkdiqqatgdvvtdiralgsmvavelet
aeqakvvqnyamenglllltcgkygnvirflypltipaeqfrqgldilkqgfatlka

Timeline for d6wopb_:

• d6wopb_ first appeared in SCOPe 2.07