Lineage for d6t5wa_ (6t5w A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406349Protein automated matches [190044] (14 species)
    not a true protein
  7. 2406361Species Cow (Bos taurus) [TaxId:9913] [187001] (23 PDB entries)
  8. 2406374Domain d6t5wa_: 6t5w A: [385670]
    automated match to d1tgsz_
    complexed with ca, dms, j5k, so4

Details for d6t5wa_

PDB Entry: 6t5w (more details), 1.13 Å

PDB Description: cationic trypsin in complex with a d-phe-pro-p-aminopyridine derivative (cocrystallizaton at 291 k)
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d6t5wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t5wa_ b.47.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d6t5wa_:

Click to download the PDB-style file with coordinates for d6t5wa_.
(The format of our PDB-style files is described here.)

Timeline for d6t5wa_: