Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187001] (23 PDB entries) |
Domain d6t5wa_: 6t5w A: [385670] automated match to d1tgsz_ complexed with ca, dms, j5k, so4 |
PDB Entry: 6t5w (more details), 1.13 Å
SCOPe Domain Sequences for d6t5wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t5wa_ b.47.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d6t5wa_: