![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
![]() | Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) ![]() |
![]() | Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
![]() | Protein Eglin C [54656] (1 species) |
![]() | Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries) |
![]() | Domain d1sbni_: 1sbn I: [38567] Other proteins in same PDB: d1sbne_ complexed with ca; mutant |
PDB Entry: 1sbn (more details), 2.1 Å
SCOPe Domain Sequences for d1sbni_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sbni_ d.40.1.1 (I:) Eglin C {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} ksfpevvgktvdqareyftlhypqynvyflpegspvtrdlrynrvrvfynpgtnvvnhvp hvg
Timeline for d1sbni_: