Lineage for d1sbni_ (1sbn I:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646962Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1646963Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1646964Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 1646996Protein Eglin C [54656] (1 species)
  7. 1646997Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)
  8. 1647005Domain d1sbni_: 1sbn I: [38567]
    Other proteins in same PDB: d1sbne_
    complexed with ca; mutant

Details for d1sbni_

PDB Entry: 1sbn (more details), 2.1 Å

PDB Description: refined crystal structures of subtilisin novo in complex with wild- type and two mutant eglins. comparison with other serine proteinase inhibitor complexes
PDB Compounds: (I:) eglin c

SCOPe Domain Sequences for d1sbni_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbni_ d.40.1.1 (I:) Eglin C {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
ksfpevvgktvdqareyftlhypqynvyflpegspvtrdlrynrvrvfynpgtnvvnhvp
hvg

SCOPe Domain Coordinates for d1sbni_:

Click to download the PDB-style file with coordinates for d1sbni_.
(The format of our PDB-style files is described here.)

Timeline for d1sbni_: