Lineage for d1teci_ (1tec I:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) 
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins) Protein Eglin C [54656] (1 species) Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries) 
Domain d1teci_: 1tec I: [38566]
Other proteins in same PDB: d1tece_
Details for d1teci_
PDB Entry: 1tec (more details), 2.2 Å
PDB Description: crystallographic refinement by incorporation of molecular dynamics. the thermostable serine protease thermitase complexed with eglin-c
SCOP Domain Sequences for d1teci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1teci_ d.40.1.1 (I:) Eglin C {Leech (Hirudo medicinalis)}
ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp
hvg
SCOP Domain Coordinates for d1teci_:
Click to download the PDB-style file with coordinates for d1teci_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1teci_:
- d1teci_ appears in SCOP 1.57
- d1teci_ appears in the current release, SCOPe 2.08
View in 3D
