Lineage for d6tpub1 (6tpu B:514-605)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2359497Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2359498Protein automated matches [190976] (4 species)
    not a true protein
  7. 2359522Species Human (Homo sapiens) [TaxId:9606] [188649] (64 PDB entries)
  8. 3085593Domain d6tpub1: 6tpu B:514-605 [385655]
    Other proteins in same PDB: d6tpua3
    automated match to d2edya1
    complexed with cl

Details for d6tpub1

PDB Entry: 6tpu (more details), 1.55 Å

PDB Description: crystal structures of fniii domain three and four of the human leucocyte common antigen-related protein, lar
PDB Compounds: (B:) Receptor-type tyrosine-protein phosphatase F

SCOPe Domain Sequences for d6tpub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tpub1 b.1.2.0 (B:514-605) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpadfqaevesdtriqlswllppqeriimyelvywaaededqqhkvtfdptssytledlk
pdtlyrfqlaarsdmgvgvftptieartaqst

SCOPe Domain Coordinates for d6tpub1:

Click to download the PDB-style file with coordinates for d6tpub1.
(The format of our PDB-style files is described here.)

Timeline for d6tpub1:

  • d6tpub1 is new in SCOPe 2.07-stable