Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) |
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins) |
Protein Eglin C [54656] (1 species) |
Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries) |
Domain d1acbi_: 1acb I: [38565] Other proteins in same PDB: d1acbe_ |
PDB Entry: 1acb (more details), 2 Å
SCOP Domain Sequences for d1acbi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1acbi_ d.40.1.1 (I:) Eglin C {Leech (Hirudo medicinalis)} ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp hvg
Timeline for d1acbi_: