Lineage for d1acbi_ (1acb I:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410813Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 410814Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) (S)
  5. 410815Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)
  6. 410829Protein Eglin C [54656] (1 species)
  7. 410830Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)
  8. 410837Domain d1acbi_: 1acb I: [38565]
    Other proteins in same PDB: d1acbe_

Details for d1acbi_

PDB Entry: 1acb (more details), 2 Å

PDB Description: crystal and molecular structure of the bovine alpha-chymotrypsin-eglin c complex at 2.0 angstroms resolution

SCOP Domain Sequences for d1acbi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acbi_ d.40.1.1 (I:) Eglin C {Leech (Hirudo medicinalis)}
ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp
hvg

SCOP Domain Coordinates for d1acbi_:

Click to download the PDB-style file with coordinates for d1acbi_.
(The format of our PDB-style files is described here.)

Timeline for d1acbi_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1acbe_