Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) |
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins) automatically mapped to Pfam PF00280 |
Protein Eglin C [54656] (1 species) |
Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries) |
Domain d3teci_: 3tec I: [38564] Other proteins in same PDB: d3tece_ complexed with ca |
PDB Entry: 3tec (more details), 2 Å
SCOPe Domain Sequences for d3teci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3teci_ d.40.1.1 (I:) Eglin C {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp hvg
Timeline for d3teci_: