SCOPe 2.07: Domain d3teci_: 3tec I:

Lineage for d3teci_ (3tec I:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein Eglin C [54656] (1 species)

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)

8. Domain d3teci_: 3tec I: [38564]
   Other proteins in same PDB: d3tece_
   complexed with ca

Details for d3teci_

PDB Entry: 3tec, 2 Å

PDB Description: calcium binding to thermitase. crystallographic studies of thermitase at 0, 5 and 100 mm calcium

PDB Compounds: (I:) eglin c

SCOPe Domain Sequences for d3teci_:

Sequence; same for both SEQRES and ATOM records:

>d3teci_ d.40.1.1 (I:) Eglin C {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp
hvg

Timeline for d3teci_:

• d3teci_ first appeared (with stable ids) in SCOP 1.55
  
• d3teci_ appears in SCOPe 2.06
  
• d3teci_ appears in the current release, SCOPe 2.08