SCOPe 2.04: Domain d1egp.1: 1egp A:,B:

Lineage for d1egp.1 (1egp A:,B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
   automatically mapped to Pfam PF00280

6. Protein Eglin C [54656] (1 species)

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)

8. Domain d1egp.1: 1egp A:,B: [38561]
   cleaved between residues 45 and 46

Details for d1egp.1

PDB Entry: 1egp, 2 Å

PDB Description: proteinase inhibitor eglin c with hydrolysed reactive center

PDB Compounds: (A:) eglin-c, (B:) eglin-c

SCOPe Domain Sequences for d1egp.1:

Sequence; same for both SEQRES and ATOM records:

>g1egp.1 d.40.1.1 (A:,B:) Eglin C {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
lksfpevvgktvdqareyftlhypqynvyflpegspvtlXynrvrvfynpgtnvvnhvph
vg

Timeline for d1egp.1:

• d1egp.1 first appeared (with stable ids) in SCOP 1.55
  
• d1egp.1 appears in SCOPe 2.03
  
• d1egp.1 appears in SCOPe 2.05
  
• d1egp.1 appears in the current release, SCOPe 2.08