Lineage for d1egp.1 (1egp A:,B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2512772Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2512773Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2512774Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 protein domains)
    automatically mapped to Pfam PF00280
  6. 2512806Protein Eglin C [54656] (1 species)
  7. 2512807Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)
  8. 2512809Domain d1egp.1: 1egp A:,B: [38561]
    cleaved between residues 45 and 46

Details for d1egp.1

PDB Entry: 1egp (more details), 2 Å

PDB Description: proteinase inhibitor eglin c with hydrolysed reactive center
PDB Compounds: (A:) eglin-c, (B:) eglin-c

SCOPe Domain Sequences for d1egp.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1egp.1 d.40.1.1 (A:,B:) Eglin C {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
lksfpevvgktvdqareyftlhypqynvyflpegspvtlXynrvrvfynpgtnvvnhvph
vg

SCOPe Domain Coordinates for d1egp.1:

Click to download the PDB-style file with coordinates for d1egp.1.
(The format of our PDB-style files is described here.)

Timeline for d1egp.1: