Lineage for d1csei_ (1cse I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1902783Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1902784Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1902785Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (5 proteins)
    automatically mapped to Pfam PF00280
  6. 1902817Protein Eglin C [54656] (1 species)
  7. 1902818Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)
  8. 1902819Domain d1csei_: 1cse I: [38559]
    Other proteins in same PDB: d1csee_
    complexed with ca

Details for d1csei_

PDB Entry: 1cse (more details), 1.2 Å

PDB Description: the high-resolution x-ray crystal structure of the complex formed between subtilisin carlsberg and eglin c, an elastase inhibitor from the leech hirudo medicinalis. structural analysis, subtilisin structure and interface geometry
PDB Compounds: (I:) eglin c

SCOPe Domain Sequences for d1csei_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csei_ d.40.1.1 (I:) Eglin C {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
ksfpevvgktvdqareyftlhypqynvyflpegspvtldlrynrvrvfynpgtnvvnhvp
hvg

SCOPe Domain Coordinates for d1csei_:

Click to download the PDB-style file with coordinates for d1csei_.
(The format of our PDB-style files is described here.)

Timeline for d1csei_: