SCOP 1.75: Domain d1csei_: 1cse I:

Lineage for d1csei_ (1cse I:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
   alpha+beta sandwich; loop across free side of beta-sheet

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)

6. Protein Eglin C [54656] (1 species)

7. Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)

8. Domain d1csei_: 1cse I: [38559]
   Other proteins in same PDB: d1csee_
   complexed with ca

Details for d1csei_

PDB Entry: 1cse, 1.2 Å

PDB Description: the high-resolution x-ray crystal structure of the complex formed between subtilisin carlsberg and eglin c, an elastase inhibitor from the leech hirudo medicinalis. structural analysis, subtilisin structure and interface geometry

PDB Compounds: (I:) eglin c

SCOP Domain Sequences for d1csei_:

Sequence; same for both SEQRES and ATOM records:

>d1csei_ d.40.1.1 (I:) Eglin C {Leech (Hirudo medicinalis) [TaxId: 6421]}
ksfpevvgktvdqareyftlhypqynvyflpegspvtldlrynrvrvfynpgtnvvnhvp
hvg

Timeline for d1csei_:

• d1csei_ first appeared (with stable ids) in SCOP 1.55
  
• d1csei_ appears in SCOP 1.73
  
• d1csei_ appears in SCOPe 2.01
  
• d1csei_ appears in the current release, SCOPe 2.08