Lineage for d1csei_ (1cse I:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191184Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
  4. 191185Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) (S)
  5. 191186Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)
  6. 191200Protein Eglin C [54656] (1 species)
  7. 191201Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)
  8. 191202Domain d1csei_: 1cse I: [38559]
    Other proteins in same PDB: d1csee_

Details for d1csei_

PDB Entry: 1cse (more details), 1.2 Å

PDB Description: the high-resolution x-ray crystal structure of the complex formed between subtilisin carlsberg and eglin c, an elastase inhibitor from the leech hirudo medicinalis. structural analysis, subtilisin structure and interface geometry

SCOP Domain Sequences for d1csei_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csei_ d.40.1.1 (I:) Eglin C {Leech (Hirudo medicinalis)}
ksfpevvgktvdqareyftlhypqynvyflpegspvtldlrynrvrvfynpgtnvvnhvp
hvg

SCOP Domain Coordinates for d1csei_:

Click to download the PDB-style file with coordinates for d1csei_.
(The format of our PDB-style files is described here.)

Timeline for d1csei_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1csee_