Lineage for d6sqnc_ (6sqn C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952186Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 2952191Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. 2952210Domain d6sqnc_: 6sqn C: [385560]
    automated match to d1numa_
    mutant

Details for d6sqnc_

PDB Entry: 6sqn (more details), 2.05 Å

PDB Description: structure of the u1a variant a1-98 y31h/q36r/f56w triple mutant co- crystallized with rna
PDB Compounds: (C:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d6sqnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sqnc_ d.58.7.1 (C:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
vpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqawvifkev
ssatnalrsmqgfpfydkpmriqyaktdsdiiakm

SCOPe Domain Coordinates for d6sqnc_:

Click to download the PDB-style file with coordinates for d6sqnc_.
(The format of our PDB-style files is described here.)

Timeline for d6sqnc_: