Lineage for d1f95b_ (1f95 B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721724Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 721725Superfamily d.39.1: DLC [54648] (1 family) (S)
  5. 721726Family d.39.1.1: DLC [54649] (2 proteins)
    8 kDa dynein light chain, DLC8
  6. 721727Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 721737Species Rat (Rattus norvegicus) [TaxId:10116] [54652] (5 PDB entries)
  8. 721739Domain d1f95b_: 1f95 B: [38556]
    complex with a BIM peptide

Details for d1f95b_

PDB Entry: 1f95 (more details)

PDB Description: solution structure of dynein light chain 8 (dlc8) and bim peptide complex
PDB Compounds: (B:) dynein

SCOP Domain Sequences for d1f95b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f95b_ d.39.1.1 (B:) Dynein light chain 1 (DLC1) {Rat (Rattus norvegicus) [TaxId: 10116]}
mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg

SCOP Domain Coordinates for d1f95b_:

Click to download the PDB-style file with coordinates for d1f95b_.
(The format of our PDB-style files is described here.)

Timeline for d1f95b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f95a_