SCOP 1.75: Domain d1f96a_: 1f96 A:

Lineage for d1f96a_ (1f96 A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)

5. Family d.39.1.1: DLC [54649] (2 proteins)
   8 kDa dynein light chain, DLC8

6. Protein Dynein light chain 1 (DLC1) [54650] (3 species)
   synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase

7. Species Rat (Rattus norvegicus) [TaxId:10116] [54652] (5 PDB entries)

8. Domain d1f96a_: 1f96 A: [38553]
   complex with a NOS peptide

Details for d1f96a_

PDB Entry: 1f96

PDB Description: solution structure of dynein light chain 8 (dlc8) and nnos peptide complex

PDB Compounds: (A:) dynein light chain 8

SCOP Domain Sequences for d1f96a_:

Sequence; same for both SEQRES and ATOM records:

>d1f96a_ d.39.1.1 (A:) Dynein light chain 1 (DLC1) {Rat (Rattus norvegicus) [TaxId: 10116]}
mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg

Timeline for d1f96a_:

• d1f96a_ first appeared (with stable ids) in SCOP 1.55
  
• d1f96a_ appears in SCOP 1.73
  
• d1f96a_ appears in SCOPe 2.01
  
• d1f96a_ appears in the current release, SCOPe 2.08