SCOPe 2.07: Domain d6rbca2: 6rbc A:118-350

Lineage for d6rbca2 (6rbc A:118-350)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.4: PA domain [52025] (1 family)

5. Family c.8.4.1: PA domain [52026] (2 proteins)

6. Protein Glutamate carboxypeptidase II [141984] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141985] (34 PDB entries)
   Uniprot Q04609 118-350

8. Domain d6rbca2: 6rbc A:118-350 [385528]
   Other proteins in same PDB: d6rbca1, d6rbca3
   automated match to d2c6ca2
   complexed with bma, ca, cl, jx5, man, nag, zn

Details for d6rbca2

PDB Entry: 6rbc, 1.77 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a inhibitor kb1157

PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d6rbca2:

Sequence; same for both SEQRES and ATOM records:

>d6rbca2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn

Timeline for d6rbca2:

• d6rbca2 is new in SCOPe 2.07-stable
  
• d6rbca2 appears in the current release, SCOPe 2.08