Lineage for d1cmib_ (1cmi B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859008Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 859009Superfamily d.39.1: DLC [54648] (1 family) (S)
  5. 859010Family d.39.1.1: DLC [54649] (2 proteins)
    8 kDa dynein light chain, DLC8
  6. 859011Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 859020Species Human (Homo sapiens) [TaxId:9606] [54651] (1 PDB entry)
  8. 859022Domain d1cmib_: 1cmi B: [38552]
    complex with a NOS peptide (residue 230-242)

Details for d1cmib_

PDB Entry: 1cmi (more details), 2.5 Å

PDB Description: structure of the human pin/lc8 dimer with a bound peptide
PDB Compounds: (B:) protein inhibitor of neuronal nitric oxide synthase

SCOP Domain Sequences for d1cmib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmib_ d.39.1.1 (B:) Dynein light chain 1 (DLC1) {Human (Homo sapiens) [TaxId: 9606]}
kaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgrnfgs
yvthetkhfiyfylgqvaillfksg

SCOP Domain Coordinates for d1cmib_:

Click to download the PDB-style file with coordinates for d1cmib_.
(The format of our PDB-style files is described here.)

Timeline for d1cmib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cmia_