Lineage for d6m54x_ (6m54 X:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2315702Species Human (Homo sapiens) [TaxId:9606] [187027] (50 PDB entries)
  8. 2315815Domain d6m54x_: 6m54 X: [385498]
    automated match to d5up8a_
    complexed with fe2

Details for d6m54x_

PDB Entry: 6m54 (more details), 2.4 Å

PDB Description: human apo ferritin frozen on tem grid with amorphous nickel titanium alloy supporting film
PDB Compounds: (X:) ferritin heavy chain

SCOPe Domain Sequences for d6m54x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m54x_ a.25.1.1 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtl

SCOPe Domain Coordinates for d6m54x_:

Click to download the PDB-style file with coordinates for d6m54x_.
(The format of our PDB-style files is described here.)

Timeline for d6m54x_: