![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
![]() | Family d.38.1.3: Acyl-CoA thioesterase [54644] (2 proteins) duplication: consists of two domains of this fold |
![]() | Protein Thioesterase II (TesB) [54645] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [54646] (1 PDB entry) |
![]() | Domain d1c8ua2: 1c8u A:116-286 [38548] complexed with lda |
PDB Entry: 1c8u (more details), 1.9 Å
SCOPe Domain Sequences for d1c8ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8ua2 d.38.1.3 (A:116-286) Thioesterase II (TesB) {Escherichia coli [TaxId: 562]} ehqktmpsapapdglpsetqiaqslahllppvlkdkficdrplevrpvefhnplkghvae phrqvwirangsvpddlrvhqyllgyasdlnflpvalqphgigflepgiqiatidhsmwf hrpfnlnewllysvestsassargfvrgefytqdgvlvastvqegvmrnhn
Timeline for d1c8ua2: