Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (25 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [385403] (1 PDB entry) |
Domain d6m10c_: 6m10 C: [385476] automated match to d3fisa_ |
PDB Entry: 6m10 (more details), 2.99 Å
SCOPe Domain Sequences for d6m10c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m10c_ a.4.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} ttptqegqtlrdsvekalhnyfahlegqpvtdvynmvlceveaplletvmnhvkgnqtka sellglnrgtlrkklkqydl
Timeline for d6m10c_: