SCOP 1.71: Domain d1c8ua1: 1c8u A:2-115

Lineage for d1c8ua1 (1c8u A:2-115)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families)

5. Family d.38.1.3: Thioesterase II (TesB) [54644] (1 protein)
   duplication: consists of two domains of this fold

6. Protein Thioesterase II (TesB) [54645] (1 species)

7. Species Escherichia coli [TaxId:562] [54646] (1 PDB entry)

8. Domain d1c8ua1: 1c8u A:2-115 [38547]

Details for d1c8ua1

PDB Entry: 1c8u, 1.9 Å

PDB Description: crystal structure of the e.coli thioesterase ii, a homologue of the human nef-binding enzyme

SCOP Domain Sequences for d1c8ua1:

Sequence; same for both SEQRES and ATOM records:

>d1c8ua1 d.38.1.3 (A:2-115) Thioesterase II (TesB) {Escherichia coli}
sqalknlltllnlekieeglfrgqsedlglrqvfggqvvgqalyaaketvpeerlvhsfh
syflrpgdskkpiiydvetlrdgnsfsarrvaaiqngkpifymtasfqapeagf

Timeline for d1c8ua1:

• d1c8ua1 first appeared (with stable ids) in SCOP 1.55
  
• d1c8ua1 appears in SCOP 1.69
  
• d1c8ua1 appears in SCOP 1.73
  
• d1c8ua1 appears in the current release, SCOPe 2.08