Lineage for d6k0ob1 (6k0o B:795-895)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002785Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 3002786Superfamily d.170.1: SRCR-like [56487] (3 families) (S)
  5. 3002798Family d.170.1.0: automated matches [331628] (1 protein)
    not a true family
  6. 3002799Protein automated matches [331629] (4 species)
    not a true protein
  7. 3002803Species Human (Homo sapiens) [TaxId:9606] [382368] (6 PDB entries)
  8. 3002811Domain d6k0ob1: 6k0o B:795-895 [385456]
    Other proteins in same PDB: d6k0oa2, d6k0oa3, d6k0ob2, d6k0ob3
    automated match to d5hrja_

Details for d6k0ob1

PDB Entry: 6k0o (more details), 1.99 Å

PDB Description: the crystal structure of human cd163-like homolog srcr8
PDB Compounds: (B:) Scavenger receptor cysteine-rich type 1 protein M160

SCOPe Domain Sequences for d6k0ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k0ob1 d.170.1.0 (B:795-895) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prlvgadmpcsgrvevkhadtwrsvcdsdfslhaanvlcrelncgdaislsvgdhfgkgn
gltwaekfqcegsethlalcpivqhpedtcihsrevgvvcs

SCOPe Domain Coordinates for d6k0ob1:

Click to download the PDB-style file with coordinates for d6k0ob1.
(The format of our PDB-style files is described here.)

Timeline for d6k0ob1: