Lineage for d1mkba_ (1mkb A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1410079Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 1410080Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species)
  7. 1410081Species Escherichia coli [TaxId:562] [54643] (4 PDB entries)
  8. 1410084Domain d1mkba_: 1mkb A: [38545]

Details for d1mkba_

PDB Entry: 1mkb (more details), 2 Å

PDB Description: escherichia coli beta-hydroxydecanoyl thiol ester dehydrase at ph 5 and 21 degrees c
PDB Compounds: (A:) beta-hydroxydecanoyl thiol ester dehydrase

SCOPe Domain Sequences for d1mkba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkba_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf

SCOPe Domain Coordinates for d1mkba_:

Click to download the PDB-style file with coordinates for d1mkba_.
(The format of our PDB-style files is described here.)

Timeline for d1mkba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mkbb_